PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G356100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 324aa    MW: 35853.3 Da    PI: 6.6402
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G356100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-51181431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtd+elv +yL++k++g +l++  +i+evd+yk++Pw Lp ++  ++kewyfF++rd+ky++g+r+nra+ +gyWkatg dk+
  Brast02G356100.1.p  18 LPPGFRFHPTDDELVEHYLCRKAAGGRLPV-PIIAEVDLYKFDPWALPDRALFGTKEWYFFTPRDRKYPNGSRPNRAAGNGYWKATGADKP 107
                         79****************************.88***************8777899************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v   +g++ g+kk Lvfy g+apkg+ktdW+mheyrl
  Brast02G356100.1.p 108 VAP-HGRTLGIKKALVFYAGKAPKGVKTDWIMHEYRL 143
                         *99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-6414172IPR003441NAC domain
PROSITE profilePS5100559.56718172IPR003441NAC domain
PfamPF023654.2E-2719143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGMAVRRRER DAEAELNLPP GFRFHPTDDE LVEHYLCRKA AGGRLPVPII AEVDLYKFDP  60
WALPDRALFG TKEWYFFTPR DRKYPNGSRP NRAAGNGYWK ATGADKPVAP HGRTLGIKKA  120
LVFYAGKAPK GVKTDWIMHE YRLADAGRAA AAGAKKGSLR LDDWVLCRLY NKKNEWEKMQ  180
MQMQGEKEAR KQEESEDMVI TSHSNNNNNS SQQSHSWGEA RTPESEIVDH DDPSSFPAFQ  240
SPAAQEMLAT MMVPKKEAAD DAGAGAGGRS DLFVDLSYDD IQSMYSGLDM MPPGDDLLYS  300
SLFASPRVRG GSQAGVSSMP GPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-10811781174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2491021e-170AK249102.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf19c03, mRNA sequence.
GenBankJX8558051e-170JX855805.1 Hordeum vulgare NAC transcription factor (NAC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563852.10.0PREDICTED: NAC domain-containing protein 67-like
SwissprotQ7EZT11e-105NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLI1GLQ00.0I1GLQ0_BRADI; Uncharacterized protein
STRINGBRADI1G04150.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.16e-77NAC family protein